PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01025198001
Common NameLOC100256989, VIT_06s0004g02750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 547aa    MW: 60398.8 Da    PI: 8.6851
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01025198001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B363.72.9e-20561371699
                        EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        lvl +  a +++ ++e++ t++ +d +g+ W++++iyr++++r++lt+GW+ Fv++++L +gD++vF   + +++ l+v+++r+
  GSVIVT01025198001  56 LVLCRVAAVKFMADPETDETVIAKDVHGEIWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFL--RAENGDLCVGIRRA 137
                        7788888888988999999*************************************************..4488999****997 PP

2Auxin_resp116.62.2e-38162245183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrl.sGtvvgvsdldpvrWpnSkWrsLk 83 
                        aa+ a+++++FevvY+Prast+eF+vk++ v++a++++++ GmRfkm fetedss++++ +Gt+++v+ +dp+rWpnS+Wr+L+
  GSVIVT01025198001 162 AATLAANGQPFEVVYYPRASTPEFCVKASGVRSAVRIQWCSGMRFKMPFETEDSSRISWfMGTISSVQVADPIRWPNSPWRLLQ 245
                        68899*****************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010192.7E-1348138IPR003340B3 DNA binding domain
PfamPF023622.5E-1856137IPR003340B3 DNA binding domain
CDDcd100173.49E-1556136No hitNo description
Gene3DG3DSA:2.40.330.104.2E-2357140IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.79E-1868138IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.58975138IPR003340B3 DNA binding domain
PfamPF065072.9E-33162245IPR010525Auxin response factor
PROSITE profilePS5174519.644434514IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007389Biological Processpattern specification process
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009743Biological Processresponse to carbohydrate
GO:0010154Biological Processfruit development
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0048366Biological Processleaf development
GO:0048441Biological Processpetal development
GO:0048442Biological Processsepal development
GO:0048589Biological Processdevelopmental growth
GO:0048829Biological Processroot cap development
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MKETEKSLDS QLWHACAGGM VQMPLVSSKV FYFPQGHAEH AHTNVDFAAA PRIPALVLCR  60
VAAVKFMADP ETDETVIAKD VHGEIWKFRH IYRGTPRRHL LTTGWSTFVN QKKLVAGDSI  120
VFLRAENGDL CVGIRRAKRG IAGSGGGLRG GRRVRPESVV EAATLAANGQ PFEVVYYPRA  180
STPEFCVKAS GVRSAVRIQW CSGMRFKMPF ETEDSSRISW FMGTISSVQV ADPIRWPNSP  240
WRLLQVTWDE PDLLQNVKRV SPWLVELVSN MPIIHLSPFS PPRKKLRIPQ HPDFPFDGQF  300
PMSSFSSNPL GSSSPLCCLP DNTPAGIQGA RHAQYGISLS DLHLNNKLQS GLKNNESISC  360
LLTMGNSSQN LEKSANEKTP QFLLFGQPIL TEQQMSRTCS SDAVSQVLTG KKNLSNVGFS  420
WHQGFQTTEI GLDTGHCKVF MESEDVGRSL DLSVLGSYEE LYTRLANMFG IERSETFSHV  480
LYRDATGAVK HTGDEPFSDF TKKAKRLTIL MDSGSNNIGR TWITGMRNAE NGLDSSNKTG  540
PLSIFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A5e-4864266187388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4388761e-180AM438876.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X090426.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651173.10.0PREDICTED: auxin response factor 18
RefseqXP_010651172.10.0PREDICTED: auxin response factor 18
RefseqXP_010651171.10.0PREDICTED: auxin response factor 18
RefseqXP_010651170.10.0PREDICTED: auxin response factor 18
RefseqXP_002282437.10.0PREDICTED: auxin response factor 18
SwissprotQ653H70.0ARFR_ORYSJ; Auxin response factor 18
TrEMBLF6GU140.0F6GU14_VITVI; Auxin response factor
STRINGVIT_06s0004g02750.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5261578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28350.11e-179auxin response factor 10